logo minsportzk.ru MINSPORTZK.RU | Личный кабинет | Наши Контакты | Доставка товара

Блузка DG(599)-SNN р.48


Женская футболка с принтом. Модель выполнена из мягкого трикотажа. Отличный выбор для любого случая.

В изделии использованы цвета: белый и др.

Параметры девушки-фотомодели:
Рост - 180 см
Размер - 52
Обхват груди - 104 ± 1 см
Обхват талии - 82 ± 1 см
Обхват бёдер - 112 ± 1 см
Длина переда до талии - 50 ± 1 см
Длина спины до талии - 45 ± 1 см
Длина руки - 62 ± 1 см

1890 РУБ

LacyWear dg-599-snn похожие

Подробнее

Блузка


Цветная блузка с круглой горловиной и рукавами 3/4. Модель выполнена из приятного материала. Отличный выбор для любого случая.

В изделии использованы цвета: синий, белый, голубой

Параметры девушки-фотомодели:
Рост - 180 см
Размер - 52
Обхват груди - 104 ± 1 см
Обхват талии - 82 ± 1 см
Обхват бёдер - 112 ± 1 см
Длина переда до талии - 50 ± 1 см
Длина спины до талии - 45 ± 1 см
Длина руки - 62 ± 1 см

1899 РУБ

LacyWear dg-602-snn похожие

Подробнее

Водолазка


Универсальная водолазка с короткими рукавами. Модель выполнена из приятного материала. Отличный выбор для повседневного гардероба.

В изделии использованы цвета: серый

Рост девушки-фотомодели 170 см.

1099 РУБ

LacyWear dg-551-snn похожие

Подробнее

Блузка


Красивая блузка с короткими рукавами. Модель выполнена из мягкой вискозы. Отличный выбор для повседневного гардероба.

Цвет: серый

Рост девушки-фотомодели 180 см

999 РУБ

LacyWear dg-213-snn похожие

Подробнее

Блузка


Однотонная блузка с круглой горловиной, короткими рукавами и декоративным элементом у горловины. Модель выполнена из приятного материала. Отличный выбор для любого случая.

Цвет: красный

Ростовка изделия 170 см.

1799 РУБ

LacyWear dg-72-snn похожие

Подробнее

Блузка


Цветная блузка с принтом. Модель выполнена из мягкой вискозы. Отличный выбор для любого случая.

В изделии использованы цвета: фуксия и др.

Рост девушки-фотомодели 170 см

2040 РУБ

LacyWear dg-499-snn похожие

Подробнее

Блузка


Однотонная блузка с короткими рукавами. Модель выполнена из приятного материала. Отличный выбор для повседневного гардероба.

В изделии использованы цвета: зеленый

Рост девушки-фотомодели 180 см

1599 РУБ

LacyWear dg-431-snn похожие

Подробнее

Блузка


Красивая блузка с короткими рукавами. Модель выполнена из приятного материала. Отличный выбор для повседневного гардероба.

Цвет: черный

Рост девушки-фотомодели 180 см

1199 РУБ

LacyWear dg-164-snn похожие

Подробнее

Блузка


Великолепная блузка свободного силуэта. Модель выполнена из мягкой вискозы. Отличный выбор для повседневного гардероба.

Цвет: желтый

Рост девушки-фотомодели 180 см

1599 РУБ

LacyWear dg-128-snn похожие

Подробнее

Блузка


Великолепная блузка свободного силуэта. Модель выполнена из мягкой вискозы. Отличный выбор для повседневного гардероба.

Цвет: белый

Рост девушки-фотомодели 180 см

1599 РУБ

LacyWear dg-123-snn похожие

Подробнее

Блузка


Красивая блузка с короткими рукавами. Модель выполнена из приятного материала. Отличный выбор для повседневного гардероба.

Цвет: зеленый

Рост девушки-фотомодели 180 см.

2290 РУБ

LacyWear dg-225-snn похожие

Подробнее

Блузка


Удлиненная блузка с короткими рукавами. Модель выполнена из мягкой вискозы. Отличный выбор для повседневного гардероба.

Цвет: черный

Рост девушки-фотомодели 170 см

1499 РУБ

LacyWear dg-145-snn похожие

Подробнее

Джемпер


Прекрасный джемпер с воротником "хомут" и длинным рукавом. Одежда, прежде всего, должна быть удобной, практичной и красивой. В нашей одежде Вы будете чувствовать себя комфортно.

В изделии использованы цвета: темно-синий

Рост девушки-фотомодели 173 см

3390 РУБ

LacyWear dg-578-snn похожие

Подробнее

Джемпер


Цветной джемпер с длинными рукавами. Модель выполнена из приятного материала. Отличный выбор для повседневного гардероба.

В изделии использованы цвета: серый, черный

Рост девушки-фотомодели 170 см

1890 РУБ

LacyWear dg-377-snn похожие

Подробнее

MOD602-06-N - Люстра подвесная Maytoni Miraggio, 6 ламп...

MBS DG-602: фото, видео, характеристики, описание и многое другое. ... MBS DG-602. ПОСМОТРЕТЬВ магазине:ВСТРОЙКА СОЛО23 500 руб. газовая независ., 59.40х59.40х54.30 см, 56 л, серебристый.

NCBI CDD Conserved Protein Domain PEP_TPR_lipo

8 окт. 2014 г. - LLLGIIHSNNNLSSKAEENYQKALSI EPENYTALF ... [468].NTMAAIMFNERKPAEAVKYLNMARKS DPAFLPARF NLATYHASTGDLDGAIAEYSRMVQEYPH 534 ... A HPQAQEPRLALGSHLLRKGSAAQGLTVAREAVNLA 602 gi ...

Indian companies registered - MCA

4 апр. 2015 г. - 602, U74120UP2015PTC069969, RISHTON KA SANSAR ..... ESTATE, G D AMBEKAR MARG, ABHYUDAYA NAGAR, KALACHOWKY MUMBAI ...... Business Services, B-1-1202, SNN Raj Serinity, Yelenahalli Village, Bergur, ...

Cp4.1LG05g06780.1 (mRNA) Cucurbita pepo (Zucchini) | Cucurbit ...

Name, Cp4.1LG05g06780.1. Type, mRNA. Organism, Cucurbita pepo (Cucurbita pepo (Zucchini)). Description, Transcriptional corepressor SEUSS. Location ...

STOCKHOLM 1.0 #=GF ID CBM_6 #=GF AC PF03422.14 #=GF DE ...

... SE Pfam-B_1231 (release 6.6) #=GF BM hmmbuild HMM.ann SEED.ann #=GF SM hmmsearch -Z 26740544 -E 1000 ...... WFEV-- W7Y1Z6.1/486-602 QAENY.

County Business Patterns, Massachusetts

... 026 7 947 17 079 Payrol|.snn ($1.000) 2 481 895 16 262 18 899 50 820 118 141 ... 602 998 255 539 825 766 41 Localandhtenirbsnpassengertranslt Number of ... (D) (D - - Payroll.ann ($1.000) D D 1913 2 201 10111 D D Dg _ _ Table 1c'.

Cardioprotective Effects of Short-Term Caloric Restriction Are ...

2002; 90: 602–608. ... Scholar; 33 Kudo N, Barr AJ, Barr RL, Desai S, Lopaschuk GD. ... synthesis during reperfusion after coronary artery occlusion in the dog.

Case No COMP/M.4439 – Ryanair / Aer Lingus REGULATION (EC ...

27 июн. 2007 г. - RNS, SCQ as well as SNN where only the Merging Parties are based). ...... 602 It should be noted that two of the four competitors Ryanair refers ...

Zur Theorie des Durchgangs schneller Korpuskularstrahlen durch ...

... in pp and Pb-Pb collisions at sNN=2.76$$ \sqrt{s_{\mathrm{NN}}}=2.76 $$ TeV, ...... J. D. Chapman, D. G. Charlton, C. C. Chau, C. A. Chavez Barajas, ...... Sensitive in the Manganese Perovskites?, MRS Proceedings, 602, (1999).

Dg 602 snn. Вcтраиваемый духовой шкаф MBS DG-602 - mbs - кухонная техника

Втраиваемый духовой шкаф MBS DG-602. ... DG-602. Назад к списку · Версия для печати. Встраиваемый газовый духовой шкаф MBS DG-602. Увеличить ...Не найдено: snnКупить Духовой шкаф MBS DG-602 по выгодной цене на Яндекс ...https://market.yandex.ru/product--dukhovoi-shkaf-mbs-dg-602/6172961Сохраненная копия Рейтинг: 3 - ‎10 голосовДуховой шкаф MBS DG-602 — купить сегодня c доставкой и гарантией по выгодной цене. Духовой шкаф MBS DG-602: характеристики, фото, магазины ...Не найдено: snnГазовая духовка MBS™ DG-602 - купить по специальной цене в ...www.mbs-deluxe.ru › Духовки › Газовые духовкиСохраненная копия1 янв. 2019 г. - MBS DG-602 - встраиваемый газовой духовой шкаф объемом 56 л. Вы можете использовать духовой шкаф для жарки, выпечки или ...Не найдено: snnКартинки по запросу dg 602 snn{"cb":18,"cl":18,"cr":18,"ct":18,"id":"jZ0yGgshJHKR1M:","ml":{"600":{"bh":90,"bw":116}},"oh":500,"ou":"https://avatars.mds.yandex.net/get-mpic/199079/img_id2659768289352574069/9hq","ow":500,"pt":"avatars.mds.yandex.net/get-mpic/199079/img_id26597...","rh":"market.yandex.ru","rid":"_suprj7iKWtB7M","rt":0,"ru":"https://market.yandex.ru/product--dukhovoi-shkaf-mbs-dg-602/6172961","sc":1,"st":"Яндекс.Маркет","th":116,"tu":"https://encrypted-tbn0.gstatic.com/images?q\u003dtbn:ANd9GcRwBX4hQPaNBxZGynk0ss9ECqB-8wJVIDEUjQ9iWUMBv4_EbZS6PYTyJ7M","tw":116}{"cb":6,"cl":3,"cr":18,"ct":21,"id":"zbNRQGLGSoa1sM:","ml":{"600":{"bh":90,"bw":142}},"oh":160,"ou":"https://autotech.ua/pics/tov/big/16072_26715.jpg","ow":800,"pt":"autotech.ua/pics/tov/big/16072_26715.jpg","rh":"autotech.ua","rid":"3suVI_jpUJbilM","rt":0,"ru":"https://autotech.ua/p/16072-denso-dg-602_svecha_nakalivaniya_denso.html","sc":1,"st":"Autotech.ua","th":90,"tu":"https://encrypted-tbn0.gstatic.com/images?q\u003dtbn:ANd9GcTezf5T2VbxM4LZO-aplSa6jdRgYRJjkJR8t8P8DTvVQJBZBLuU_afHxW4","tw":450}{"cb":6,"cl":6,"cr":6,"ct":6,"id":"1pJyI_O_O1BtXM:","ml":{"600":{"bh":90,"bw":119}},"oh":327,"ou":"http://www.mbs-deluxe.ru/i/product_i/126_4_b.jpg","ow":408,"pt":"www.mbs-deluxe.ru/i/product_i/126_4_b.jpg","rh":"mbs-deluxe.ru","rid":"zD3ERYr8OjW5sM","rt":0,"ru":"http://www.mbs-deluxe.ru/shop/mbs_dg_602.html","sc":1,"st":"МБС","th":95,"tu":"https://encrypted-tbn0.gstatic.com/images?q\u003dtbn:ANd9GcRYwX3cURqL3ybAbwcWTgMh__GQBdYRQulCWLh3WYW1ZW3uyE1KSAJHRDk","tw":119}{"id":"lrfa6hArK6522M:","ml":{"600":{"bh":90,"bw":112}},"oh":294,"ou":"http://www.mbs-deluxe.ru/i/product_i/126_5_b.jpg","ow":367,"pt":"www.mbs-deluxe.ru/i/product_i/126_5_b.jpg","rh":"mbs-deluxe.ru","rid":"zD3ERYr8OjW5sM","rt":0,"ru":"http://www.mbs-deluxe.ru/shop/mbs_dg_602.html","sc":1,"st":"МБС","th":90,"tu":"https://encrypted-tbn0.gstatic.com/images?q\u003dtbn:ANd9GcTq3MLTocfQluLQGs4LPjvvwfUJq-sYA20zD4-7WdnLYuCGeU9KfPOmtX0","tw":112}{"cb":3,"cl":3,"cr":3,"ct":3,"id":"5mkJSoQmf5MVlM:","ml":{"600":{"bh":90,"bw":95}},"oh":200,"ou":"https://avatars.mds.yandex.net/get-mpic/199079/img_id3524268733035389404/5hq","ow":200,"pt":"avatars.mds.yandex.net/get-mpic/199079/img_id35242...","rh":"market.yandex.ru","rid":"_suprj7iKWtB7M","rt":0,"ru":"https://market.yandex.ru/product--dukhovoi-shkaf-mbs-dg-602/6172961","sc":1,"st":"Яндекс.Маркет","th":95,"tu":"https://encrypted-tbn0.gstatic.com/images?q\u003dtbn:ANd9GcTIuwxePKZxETdQAj4AdquY5oIs_nGFxjeJlDExHaHxkPTRlu9p0yexLM4","tw":95}Другие картинки по запросу "dg 602 snn"Жалоба отправленаПожаловаться на картинкиБлагодарим за замечания. Пожаловаться на другую картинку.Пожаловаться на содержание картинки. ОтменаПожаловаться(function(){var a=document.querySelector("#taw"),b=document.querySelector("#topstuff");if(a&&!a.clientHeight&&b&&!b.clientHeight)for(var c=document.querySelector("#rso").children,d=0;d

DI602A датчик контроля частоты вращения

Индуктивный датчик IFM Electronic DI602A для контроля частоты вращения со склада и на заказ с доставкой по всей России. ... Датчик числа оборотов DI602A может работать в опасных зонах ATEX. Датчик скорости вращения DI602A контролирует в диапазоне от 3 до 6000 имп/ мин. E10736 кронштейн угловой. EVC490 разъем с кабелем.

Matchfakta

Banpoäng: PT+DG 3/4, AM+HL 0/4, BoT+GB 0/4, HG+MW 1/4. ... Stig-Ove Wisberg 685, Anders Fagerberg 682, Björn Tisell 602, Ann-Louise Lindström 684, ...

Prediction of Breast Resection Weight in Reduction ... - mediaTUM

10 нояб. 2016 г. - ple (SNN), nipple to inframammary fold (NIMF), nipple to medial breast ..... Turner AJ, Dujon DG. Predicting cup ... 2006;57:602-610. 33. Eder M ...

Get Special Instructions - Dav El | BostonCoach

Get special instructions by providing destination information to learn if there is a designated pickup point for that location.

РКС Компоненты

60/ 600 601 602 603 604 605 606 607 608 609 60A 60B 60C 60D 60E 60F 60G ..... ANE ANF ANG ANH ANI ANJ ANK ANL ANM ANN ANO ANP ANQ ANR ANS ..... D-C D-D D-E D-F D-G D-H D-I D-K D-L D-M D-P D-Q D-R D-S D-T D-U D-W ...

References - EMIS

120, Boulware, D. G. and Deser, S., “String Generated Gravity Models”, Phys. Rev. ..... “Observation and studies of jet quenching in PbPb collisions at √sNN--- ...... 602, Pani, P. and Cardoso, V., “Are black holes in alternative theories serious ...

issue email modest taken 4628 zymotaq serve participant TSS shown ...

... margin birth both deaton SNN program power although male ward' important ... 361 002470369 595–602 sional eter limitation support KLHL21 factor fetoprotein ... open significant arterie ESRRB DGP gestation DG CA inclusion exist height ...

Suppressed 0 Production at Large Transverse Momentum in Central ...

13 авг. 2003 г. - sNN p. И 200 GeV. S. S. Adler,5 S. Afanasiev,17 C. Aidala,5 N. N. Ajitanand,43 Y. Akiba ... J. Choi,19 R. K. Choudhury,4 T. Chujo,5 V. Cianciolo,35 Y. Cobigo,10 B. A. Cole,9 P. Constantin,16 D. G. d'Enterria,45 ..... 602:6 59:3.

Witzke W[au] - PubMed Result

Ann Neurol. 2013 May;73(5):594-602. doi: 10.1002/ana.23835. Epub 2013 Feb 26. PubMed PMID: 23443907. 2: Adamczyk L, Agakishiev G, Aggarwal MM, ...

Bibliography | Neuronal Dynamics online book

Ann Phys (NY) 173, pp. ..... [115] R. R. de Ruyter van Steveninck, G. D. Lowen, S. P. Strong, R. Koberle and W. Bialek (1997) Reproducibility and ... 555–602. Cited by: 3.3.2. [119] R.C. deCharms and M.M. Merzenich (1996) Primary cortical ...

,j FShus tees DESERT COMMUNITY COLLEGE DISTRICT

19 апр. 2002 г. - Arnes, Patricia. Beck, Don. Berry-Scott, Sue Ann (2) ...... SSN: 602-15-7605. HUMAN RESOURCES ...... 1 U j%w5i d g ~ ) o - L. 2. Purpose: I. 3.

lSO:>WO - Federal Communications Commission

22 авг. 2018 г. - Lifetime. 45 Shern Suund East. 602 Hip Hop & RSD ...... GD EB ABC Famil. 61 EB Animal Planet .... 602 CNN Español. 603 Fox Sports Español.

Станок для обработки дверей с ЧПУ ARTIKON DG-604

Производитель: Artikon. Модель: DG-604. Наличие: Предзаказ. Цена: €21500. Количество: Купить в 1 клик. Станок для сверления отверстий под замок и ручку CNC ARTIKON DG-604 — ваш заказ. Имя: Телефон

Вcтраиваемый духовой шкаф MBS DG-602 - mbs - кухонная техника

Втраиваемый духовой шкаф MBS DG-602. ... DG-602. Назад к списку · Версия для печати. Встраиваемый газовый духовой шкаф MBS DG-602. Увеличить ...Не найдено: snnКупить Духовой шкаф MBS DG-602 по выгодной цене на Яндекс ...https://market.yandex.ru/product--dukhovoi-shkaf-mbs-dg-602/6172961Сохраненная копия Рейтинг: 3 - ‎10 голосовДуховой шкаф MBS DG-602 — купить сегодня c доставкой и гарантией по выгодной цене. Духовой шкаф MBS DG-602: характеристики, фото, магазины ...Не найдено: snnГазовая духовка MBS™ DG-602 - купить по специальной цене в ...www.mbs-deluxe.ru › Духовки › Газовые духовкиСохраненная копия1 янв. 2019 г. - MBS DG-602 - встраиваемый газовой духовой шкаф объемом 56 л. Вы можете использовать духовой шкаф для жарки, выпечки или ...Не найдено: snnКартинки по запросу dg 602 snn{"cb":18,"cl":18,"cr":18,"ct":18,"id":"jZ0yGgshJHKR1M:","ml":{"600":{"bh":90,"bw":116}},"oh":500,"ou":"https://avatars.mds.yandex.net/get-mpic/199079/img_id2659768289352574069/9hq","ow":500,"pt":"avatars.mds.yandex.net/get-mpic/199079/img_id26597...","rh":"market.yandex.ru","rid":"_suprj7iKWtB7M","rt":0,"ru":"https://market.yandex.ru/product--dukhovoi-shkaf-mbs-dg-602/6172961","sc":1,"st":"Яндекс.Маркет","th":116,"tu":"https://encrypted-tbn0.gstatic.com/images?q\u003dtbn:ANd9GcRwBX4hQPaNBxZGynk0ss9ECqB-8wJVIDEUjQ9iWUMBv4_EbZS6PYTyJ7M","tw":116}{"cb":6,"cl":3,"cr":18,"ct":21,"id":"zbNRQGLGSoa1sM:","ml":{"600":{"bh":90,"bw":142}},"oh":160,"ou":"https://autotech.ua/pics/tov/big/16072_26715.jpg","ow":800,"pt":"autotech.ua/pics/tov/big/16072_26715.jpg","rh":"autotech.ua","rid":"3suVI_jpUJbilM","rt":0,"ru":"https://autotech.ua/p/16072-denso-dg-602_svecha_nakalivaniya_denso.html","sc":1,"st":"Autotech.ua","th":90,"tu":"https://encrypted-tbn0.gstatic.com/images?q\u003dtbn:ANd9GcTezf5T2VbxM4LZO-aplSa6jdRgYRJjkJR8t8P8DTvVQJBZBLuU_afHxW4","tw":450}{"cb":6,"cl":6,"cr":6,"ct":6,"id":"1pJyI_O_O1BtXM:","ml":{"600":{"bh":90,"bw":119}},"oh":327,"ou":"http://www.mbs-deluxe.ru/i/product_i/126_4_b.jpg","ow":408,"pt":"www.mbs-deluxe.ru/i/product_i/126_4_b.jpg","rh":"mbs-deluxe.ru","rid":"zD3ERYr8OjW5sM","rt":0,"ru":"http://www.mbs-deluxe.ru/shop/mbs_dg_602.html","sc":1,"st":"МБС","th":95,"tu":"https://encrypted-tbn0.gstatic.com/images?q\u003dtbn:ANd9GcRYwX3cURqL3ybAbwcWTgMh__GQBdYRQulCWLh3WYW1ZW3uyE1KSAJHRDk","tw":119}{"id":"lrfa6hArK6522M:","ml":{"600":{"bh":90,"bw":112}},"oh":294,"ou":"http://www.mbs-deluxe.ru/i/product_i/126_5_b.jpg","ow":367,"pt":"www.mbs-deluxe.ru/i/product_i/126_5_b.jpg","rh":"mbs-deluxe.ru","rid":"zD3ERYr8OjW5sM","rt":0,"ru":"http://www.mbs-deluxe.ru/shop/mbs_dg_602.html","sc":1,"st":"МБС","th":90,"tu":"https://encrypted-tbn0.gstatic.com/images?q\u003dtbn:ANd9GcTq3MLTocfQluLQGs4LPjvvwfUJq-sYA20zD4-7WdnLYuCGeU9KfPOmtX0","tw":112}{"cb":3,"cl":3,"cr":3,"ct":3,"id":"5mkJSoQmf5MVlM:","ml":{"600":{"bh":90,"bw":95}},"oh":200,"ou":"https://avatars.mds.yandex.net/get-mpic/199079/img_id3524268733035389404/5hq","ow":200,"pt":"avatars.mds.yandex.net/get-mpic/199079/img_id35242...","rh":"market.yandex.ru","rid":"_suprj7iKWtB7M","rt":0,"ru":"https://market.yandex.ru/product--dukhovoi-shkaf-mbs-dg-602/6172961","sc":1,"st":"Яндекс.Маркет","th":95,"tu":"https://encrypted-tbn0.gstatic.com/images?q\u003dtbn:ANd9GcTIuwxePKZxETdQAj4AdquY5oIs_nGFxjeJlDExHaHxkPTRlu9p0yexLM4","tw":95}Другие картинки по запросу "dg 602 snn"Жалоба отправленаПожаловаться на картинкиБлагодарим за замечания. Пожаловаться на другую картинку.Пожаловаться на содержание картинки. ОтменаПожаловаться(function(){var a=document.querySelector("#taw"),b=document.querySelector("#topstuff");if(a&&!a.clientHeight&&b&&!b.clientHeight)for(var c=document.querySelector("#rso").children,d=0;d

Nairobi Children'S Court - Kenya Law

D.G. & C. M. –VS- J. W. G.. CC 41/2009. J. N. –VS- E. L. ..... CC 570/2009. M. N. N. –VS- S. N. N.. CC 707A/2009 ...... CC 602/2013. R. N.; A. W. –VS- J. W. B..

Committee report - Document Repository

16 июн. 2014 г. - 1 DOG MOD. GEDMS ...... DEFENSE INFDRHATlON SV:Snn~ NFtwllRK ...... 4T .602. 69,026. 14,0]1. 21 '788. 42' 048. 23,5~2. 42,772. 35,315.

Untitled - Agenda INFN

of Au+Au collisions at sqrt(sNN)= 27, 39, 62.4 and 200GeV at STAR. Also, the first measurement ...... dg (d5/2, g7/2, d3/2) neutrons, which is still not sufficiently understood. High-spin spectroscopic ... 61, (2008) 602. [3] R. Palit et al., Nucl.

Indian Railway Station List with Station Code and Number of Trains ...

5 июн. 2018 г. - 602, Bhimalgondi, BMC. 603, Bhimana, BMN ..... 1180, Dindigul Junction, DG, 40. 1181, Diphu ...... 3955, Sonegaon, SNN, 1. 3956, Songadh ...

NCBI CDD Conserved Protein Domain Coatomer_WDAD

16 нояб. 2009 г. - ... VKKRLGILAALFYaPNKCAFLDK-NKNIIL--CNAHGDGekVI-KHEKNLKALFPgp-aGYILRQTE 452 gi 122093347 400 .... 602 gi 157746425 532 ...

KwaZulu-Natal - Department of Basic Education

... 1/2/1900, FALSE, TRUE, 614, 19, 605, 18, 616, 19, 624, 19, 650, 19, 19, 602 ...... UMGUNGUNDLOVU, UGU, UMKOMAZI, TO BE UPDATED, D.G, NDADANE ...

Simple and Practical Sequence Nearest Neighbors with ... - CS Rutgers

The sequence nearest neighbor (SNN) problem is as follows. ...... 602. 20. 100. 20. 601. 19. 616. 16. 609. Table 1. Signature computation for psuedo random ..... J. D. Thompson, D. G. Higgins, T. J. Gibson, Clustal-W: improving the sensitiv-.

<SEC-DOCUMENT>0000000000-13-010469.txt : 20130509 <SEC ...

Q))[$DW@23^)) M/(DG\22>Q)-X$D_B^?_R:/\_LOC;9]/PR9E1RV[G@WK?@1BM#&/R[\FMTSYU MFG>2EA-:84DZ/9-_L_(876I<Z_OY&%BF;E9<&_O93>R0 ...

General Variables

... Column593, Column594, Column595, Column596, Column597, Column598, Column599, Column600, Column601, Column602, Column603, Column604 ...

Аккумуляторная батарея (BK10, SNN5793A), 1600mAh...

Совместимые артикулы: BK10, SNN5793, SNN5793A. Если в описании товара или фотографии присутствует ошибка или неточность, мы были бы признательны, если бы Вы сообщили нам об этом. Для этого нажмите сочетание клавиш Ctrl + Enter и разместите сообщение.

Arizona Republic from Phoenix, Arizona on June 6, 2004 · Page 234

6 июн. 2004 г. - Sunday, June 6, 2004 H. " Omer AZ dtle. u neal Reaj Estate Real Estate Real Estate Real Estate inS jMgS fflMs lllil SW warn wmm i&ss i ...

STOCKHOLM 1.0 #=GF ID 2OG-FeII_Oxy_5 #=GF AC PF13759.6 ...

... #=GF SE Jackhmmr:A3JXF3 #=GF BM hmmbuild HMM.ann SEED.ann #=GF SM hmmsearch -Z 45638612 ...... R.VIIAFN A0A255Z9E7.1/508-602 -SWSSRLR.

Strategies for stroke rehabilitation - The Lancet Neurology

In: Kaler SNN, ed. Understanding and optimizing ..... 2001; 24: 602-613. View in Article ... Nair DG; Purcott KL; Fuchs A; Steinberg F; Kelso JA. Cortical and ...

Photon elliptic flow in relativistic heavy-ion collisions: hadronic versus ...

18 июл. 2013 г. - produced in minimal bias Au+Au collisions at /sNN = 200 GeV is ...... A 602, 449. (1996). ... [34] D. G. d'Enterria and D. Peressounko, Eur.Phys.

PDF(50MB)

30 окт. 1993 г. - Ann. Bull., Hiroshima Univ., Taishaku-kyo Site Res. Cent. ...... 602 KITAZATO Hiroshi (1988): Ecology of Benthic Foraminifera in the tidal zone.

Neural Networks and Neuroscience-Inspired Computer Vision ...

22 сент. 2014 г. - ... hidden layer made it possible, in principle, for an ANN to compute any function, ..... D.G. LoweObject recognition from local scale-invariant features .... a rich repertoire of complex cell properties. J. Vis., 5 (2005), pp. 579-602.

A review of detection approaches for distributed denial of service attacks

against the BBC website to 602 Gbps in the first quar- ter of 2016 (Khandelwal). ..... like DBSCAN, ROCK, SNN, FindOut, WaveCluster algorithms have been ...

Polk City Directory - Parkersburg & Wood County Public Library ...

Se\-enth~ trom 602 Ann eastward to corporation ...... A.ls .r\..ndrew, mallu.gel', Commercial lIntel, bds 320 Ann ...... Yalther D. G., cigarmaker, h 1026 ~lurdoch ay.

Aesthetic Society News - The American Society for Aesthetic Plastic ...

27 апр. 2017 г. - ANN is exclusively for .... Network (ANN), which will assist you in improving your practice with just a click of your ...... 602/702 The Safety and Efficacy of ...... dg contact Chris E mati e infor or more. Fo ge tion a. 866-461-1221 or.

Download - Pfam

... NC 22.0 22.0 #=GF TC 22.1 22.1 #=GF SE Jackhmmer:O25123 #=GF BM hmmbuild HMM.ann SEED.ann ...... EVHTI Q602Q7.1/1088-1176 -ERIAMQVVMDA.

Got 4907 bytes response, method=default Response decode error Exif ...

zWMq wb6O e:\yq Dg#Z Qo%Kk qyq> PY.8(G 9QYp GWUM: \d/NGQ $M3$ ...... ]vY_ ]Z14 c?w%& }ee5 gsg8 +K=S ^7zW ~[={ `602=+ 5y+_ =puO JJQo k)qs< ;xVR ...

компьютерный поиск веществ, обладающих ... - ИБМХ

Ann N Y Acad Sci. – 1967. – V. 141 ..... 20 – P. 597-602. 124. Perou CM ...... DG-75. Burkitt lymphoma cells. Lymphatic system. Lymphoma. CANCER. CHEMBL2.

Catalysis by Palladium Pincer Complexes - Chemical Reviews (ACS ...

Advanced Synthesis & Catalysis 2018 360 (4), 602-625 ...... Y, Lu, and Gd Complexes of NCO/NCS Pincer Ligands: Synthesis, Characterization, and Catalysis in ...

Lymphadenectomy for isolated lymph node metastasis from extremity ...

1999;229:602– Ann Surg. 1993;218:705–712. 610; discussion 10–12. 15. Rehders A, Hosch SB, Scheunemann P, et al. Benefit of sur- 4. Fong Y, Coit DG, ...

A Bibliography of Papers in Lecture Notes in ... - Index of files in

668, 1932, 135, 138, 1558, 602, 1733, 842, ...... GD [12]. GD-Workbench. [12]. Gene [1374]. General. [1832, 527, 1105, 1297, 1038, 193, 1139, ...... Li:1996:SNN.

Comparison of Instances Seletion Algorithms I. Algorithms Survey

such as SNN by Ritter et al. [5], RNN by .... 602. N. Jankowski and M. Grochowski where n and m are numbers of instances in the training set and in the new data ... Duda, R.O., Hart, P.E., Stork, D.G.: Patter Classification and Scene Analysis. 2.

Medicago: BLAST2 result

14 дек. 2001 г. - ... 405 WGKEVYMGPGTHDSDGDSLLLPSYDDDGSLLVAICLQEVHMDAFK 449 WGK ++ GP DG ++ S +GSLL ++ LQ HM K Sbjct: 567 ... 246 P+ D +L S+ + EF+ PPL +SNN K A MLK +K QVEK Sbjct: 251 .... 602 Query: 172 ...

%PDF-1.5 1 0 obj < > endobj 2 0 obj < > endobj 3 0 obj < >/ProcSet ...

LBGB A;B] 6';`jN /k;o i#u.K _zD~ W2yI < < ~4Db Gd\!w \rq< `4k3 esTRq xyHb0 oNOuX /5/I]i} +j/; _k,f- 57,_t7 B, .... *GSa HhI snN. ... 600 600 600 600 600 600 600 600] 599[ 600] 602[ 600 600 600 600 600 600 600 600 600 600 600 600 600 600 ...

Professor Robert Sneyd - University of Plymouth

After completing his UK anaesthetic training he worked at the University of Michigan Medical School at Ann Arbor, USA. In 1993, he returned to the South West ...

4frnlty

subsct:pt:on E Ptar 0a, ( rannet d g tht tpry, e ts 4A ieo a e( e\ e n., d.1d. "Available [ar ] .... 602 CNN ef Fspanol. 603 Fox ... XFINITY W 3OO LATINO ANN. xFlNlTY ...

Pfam: PF00564 - GenomeNet

... #=GF TC 21.80 21.80; #=GF NC 21.70 21.70; #=GF BM hmmbuild HMM.ann SEED.ann #=GF SM hmmsearch ...... AC A0A087GGL2.1 #=GS A5E1U6_LODEL/514-602 AC A5E1U6.1 #=GS A0A161X2G1_DAUCA/261-340 ...... EIELFCV--gd.

Znanstvene publikacije Fizickog odsjeka u 2017. godini

J/ψ Elliptic Flow in Pb-Pb Collisions at √sNN=5.02 TeV ... Linear and non-linear flow mode in Pb-Pb collisions at √sNN=2.76 TeV ...... 602, A4 (2017).

Publications - Институт ядерной физики и технологий - МИФИ

... pseudorapidity density in p–Pb collisions at sNN=5.02TeV. ...... Physics of Particles and Nuclei, 2018, 49, 4, 602-606, 10.1134/S1063779618040275; Astapov ..... Nepochataya OE Rudik DG Shakirov AV Simakov GE Sosnovtsev VV Vasin ...

effects of gibberellin on forage yields of six ... - NRC Research Press

C\b4<r. \o@rshN. iNN\O4O. doodoJ. O<rO\<tO\\O aaa9?\ ooH<1 co de{sNN. I o o. .... Food Agr.5: 602-612. 1954. 2. ... 1957. 4. Nlorgan, D. G., and G. C. trIees.

QUERY >UniRef90_Q2RFX7 >UniRef90_UPI0001CBA8E8 ...

... >UniRef90_F8KU97 >UniRef90_Q4A602 >UniRef90_UPI00047D6E36 .... DSESGDSRGNDQ ESTL KGTSG NGNE SSS DDS NNN NE SNN NNR SG ENNEGD ENGA 6 ... GDSGGGDGGGS GDSGGH NG GAGG MG G T DG EE 4 ...

STOCKHOLM 1.0 #=GF ID DUF5050 #=GF AC PF16472.4 #=GF DE ...

... hmmbuild HMM.ann SEED.ann #=GF SM hmmsearch -Z 26740544 -E 1000 --cpu 4 HMM pfamseq #=GF TP Domain #=GF WK Domain_of_unknown_function ...

GRG 84/10 Index to succession duty 'Old Act' files - State Records of ...

26 окт. 2016 г. - Ann. 1-. liHIOB. Haey Ann. 111'18. BAriOII. Richard ?oreacre. 1047'1. IU.ft. Frederick. ,..,. lJAUGHTON ...... POii:D G OR'iB. - or:i. 10175 ...... 10012. 8716. 1517. 4868. 10286. 4650. 4741. 10239. 1058. 1 551. 1026. 5934. 602.

maker-cbr1_scaffold54-augustus-gene-0.28-mRNA-2 | HWG

17 дек. 2018 г. - ... V+PS+G SNN+A Q+QFK+LQP+GA+NPSADA V+ RMQDPRGLS MS ...... 602 MDFG+MGLE LVGPE GG + KV D G GS KQ +S +DDW++SKM ...

island merit order - final year examination of "2011 a ... - Health.gov.lk

186 G.D.WALAKULUARACHCHI. 187 L.H.A.I. DE ... 267 D.G. JAYAWARDANA ..... 626. NNNN. ANN. 627. 628. 602 H.K.M. IMESHA. 603 T.I.K. WEERASINGHE.

Neuromorphic Computing of Event-Based Data - repository.tudelft.nl

19 июн. 2018 г. - DoF. Degrees-of-Freedom. DoG. Difference of Gaussians. DVS. Dynamic Vision Sensor. eDVS ..... A-1 Overview of the source code of the cuda-snn simulator. ...... 57(6), 591–602. doi: 10.1016/j.robot.2009.02.001. Kendoul, F.

Indirizzi Strutture_30_12_2015 - Ministero della Salute

... 01, 07, 2012, 06, OSPEDALE OSTETRICO GINECOLOGICO SANT'ANN, 10771180014 ...... 2004, 01, OSPEDALE `SAN BASSIANO` DI BASSANO D.G., 00913430245, VIA DEI ...... 602, 080, EMILIA ROMAGNA, 105, 908, 080908, AZIENDA ...

(PDF) Diagnostic Report II guiding improvements in the Black Sea ...

This document has been prepared with the financial assistance of EC DG Environment. ...... targets and GES indicators, taking into consideration Annex I and III of the MSFD, as well ...... 41 TRK-E3 41.18.858 N 31.19.602 E Karadeniz Ereğlisi.

Complet list of 1jgl hssp file

... OS=Macaca mulatta GN=IGHM PE=4 SV=1 105 : F7H602_MACMU 0.51 0.70 215 423 20 ...... ksddnQqq dh rdaqd gd 93 93 L S S S- 0 0 38 210 76 gaaghakg ..... ssss sndstN 27 27 L G S S- 0 0 20 222 66 kdKk.ssr dnnn snn s N Nd n.

./63_bader/m_bader.F90 - Abinit

End of the abilint section 600 601 implicit none 602 603 ! ...... 903 end if 904 end if 905 906 cycle madw 907 end if 908 909 hh=h0/dg 910 if (ldeb.or.deb) ...... 3795 else 3796 ddz(snn,tnn,:)=rsid(:) 3797 end if 3798 3799 end subroutine inspln ...

DoD Financial Management Regulation Volume 13, Appendix A ...

602-Salaries and Wages-Foreign National. Employees. ...... The standard NAFI number (SNN) in DA Form. 3434 will ...... DG 1199A Direct Deposit Sign-up Form.

Блузка DG(102)-SNN по цене 1240 руб. Купить с доставкой...

Блузка DG(102)-SNN. Красивая блузка с короткими рукавами. Модель выполнена из приятного материала. Отличный выбор для повседневного гардероба. Цвет: коралловый, белый Ростовка изделия 170 см.

Bioengineering | Free Full-Text | A Review on Bioconversion of Agro ...

28 окт. 2018 г. - Ann. Microbiol. 2012 .... 2014, 60, 602–609. .... [Google Scholar]; Vandamme, E.J.; Derycke, D.G. Microbial inulinases: Fermentation process, ...

1910 Abstract – Supplement for Kansas - Census Bureau

Retnrned as Snn in 1000. l,:US. 10,403 ...... 602. 774. 418. 536. 1,080. 1,149. 684. 698. 1,400. 1,392. 509. JB1. 909. 1,22e. 396. 591 ...... Dg Troy city .••..••.•.

United States Imports of Merchandise for Consumption: Commodity by ...

... Ф U 285905 5 1 8116 4608 495 1 936 453881468867 606 505 30862 248 О 602 7 ... ‚Н Ü Н Т T Н А N С 752Н 0 V 0» V U o i U '« ш Р A N N 8 С Е А Р w 0 88 ... N P P E E 9 DG A .dn мы А Т N C N N N R N I N 9 N E nu me R S A А S I I I U О ...

Sheet1 - Brentwood Academy

... Column593, Column594, Column595, Column596, Column597, Column598, Column599, Column600, Column601, Column602, Column603, Column604 ...

nmrML - Examples

... +80SY95Pwu3ne3dbFkFcz7DmZcahvrW+xb655y9PQm+dg+ ...... /03B/xDwx66LRy+I1P4AO+nPh2oO/vUQ8co55vob9Mwc9nDKfns+ty602jqS/ ...... +xfhfEUWdcTaznC/DnXfu/oH/SnN/XradE7rYiZ1bEo4S/jINdli4L4fs9rO8W62J/ ...

The Effectiveness of Alcohol Versus Phenol Based ... - Pain Physician

underwent SNN for cancer-related abdominal pain in order to describe patient characteristics, examine comparative ... SNN was an effective and relatively safe procedure for the treatment ...... Moore JC, Adler DG. ... Pain 1996; 64:597-602. 34.

Current and Future Industrial Energy Service Characterizations

... L *O & B " I "O Z t" ( 2 * 602 0 * 00 l C * 1 g c & 1 * 6t 6 ° 0.29 0 °0 0 °0 0 °0 O "O ... I 2 6 * 1 2 so * d g { 1 * 8 L 6 " £ 20 I { * 1 2 8 ° 91 & 0 * 0 0 1 1 * 0.09: 1 1 * 9 g .... 8 L J J H S : s , S J N J is JW 4 sh'N V w 9 to I N. V A 1A S N N c * * * * * 9 * 9t 9 *

RadishBase

... 241 Query: 602 ... 642 TD DVMWLRNPF RLS N ++D+QIS D G +L+NTGFYYV+SNN+TI+LF+ Sbjct: 185 ...

Public Comment Received on Proposed ... - Department of Energy

20 авг. 2010 г. - amongst the buzz surrounding nano solar are. “questionable ...... d g e n e ra te s la rg e q u a n titie. s o f ta ilin g s. R e d u ce d. P. G. M u se w ill d e liv ...... Available online at http://www.etcgroup.org/en/node/602 ii Andres F.

Μαρία Καρχιλάκη - CNN.gr

2015 - 2018 D.G. Newsagency S.A. CNN name, logo and all associated elements ® and © 2015 Cable News Network, Inc. All rights reserved. CNN and the ...

A Case for Hubness Removal in High–Dimensional Multimedia Retrieval

Original. SNN. LS. MP. Fig. 1. At k = 5, (a) the number of unreachable items and (b) the size of the largest hub (as .... .774 .678 .599 .715 .640 .602 .796 .715 .636 .... Lowe, D.G.: Distinctive image features from scale-invariant keypoints. Interna-.

Οι απόψεις της συντακτικής ομάδας σε θέματα επικαιρότητας - CNN.gr

2015 - 2019 D.G. Newsagency S.A. CNN name, logo and all associated elements ® and © 2015 Cable News Network, Inc. All rights reserved. CNN and the ...

Термостат US-602S | Форса трейд

US-602S Термостат Asahi. «Форса трейд» предлагает к поставке термостат US-602S Asahi Keiki производителя Asahi Keiki всем организациям в городе Москва или в любой другой город России. более 10 000 переключений; 250 В перем.; 15 А; 50 мОм. Для уточнения цен и сроков поставки присылайте, пожалуйста, маркировку требуемых Вам продуктов и их количество.

Naaukeurige versameling der gedenk-waardigste zee en land-reysen na ...

... eu l^oeäeren ee- iiexmei,)« naas Kec v2^e Q-mä over re Z22N . snn. cler c^2r 6 ... ie ontloaven/ maar nademäal °/ " de «lspitennen van ^^c,m«c2. sagen/ dg? ... fa hgast als ^ifonla^««»^ cl Kibuquerque na 602 wedernecrde/afsneed/waar na ...

Measurement with the ATLAS detector of multi-particle azimuthal ...

16 мая 2013 г. - sNN = 5.02 TeV, the second-order azimuthal anisotropy parameter of charged particles, v2, ...... 602. O. Beltramello30, O. Benary153, D. Benchekroun135a, .... J.W. Chapman87, D.G. Charlton18, V. Chavda82, C.A. Chavez ...

Yamaha R-N602 Black купить в интернет магазине

Yamaha R-N602 Black в магазине on-off-on. Подробное описание. Выгодная цена. Купить с доставкой по Москве и по всей России. Гарантия - 1 год. телефон +7 (495) 926-63-77. ... Мы пока не выложили на сайт данную инструкцию. Yamaha R-N602 Black. Компания Yamaha представляет новейший сетевой стерео ресивер входящий в серию MusicCast : Yamaha R-N602.

d eta in heavy ion collisions at mi - Iowa State University Digital ...

25 мар. 2005 г. - The √sNN dependence of dET/dη and dNch/dη per ... Y. Cobigo,10 B. A. Cole,9 P. Constantin,16 D. G. d'Enterria,45 G. David,5 H. Delagrange,45 A. ...... 602. 488. 403. 329. 270. 219. 176. 139. 109. 84.1. 64.3. 48.4. 35.2. 25.3.

Medical genetics 1962 - Journal of Chronic Diseases

(and colleagues) (¶569)Ann. Paediat. 1962; 199: .... (and colleagues) (¶791)Ann. intern. Med. .... (and colleagues) (¶521)Ann. hum. Genet. ...... 1962; 193: 602.

Ann St, Oceanside, CA 92057 - Who owns property on this street ...

Find out who lives on Ann St in Oceanside, California. We found 30 ... We found 30 addresses for Ann St, Oceanside, CA 92057. We found ... 602 Ann St

%-12345X@PJL @PJL COMMENT MODEL=HP DesignJet T730 ...

3uYo j/of\M ^d@dg =s<S dk[5 ln$p '_:} \(L5 ,bS<oP C*DC? ..... :-$Gf v(Fa 1z\99P *EWj 0~,O =P?d .k@B4 q0<Q V.}h=QvkZ n.R: "<L%) Sd$Z ]}Bf 602Y l. ...... W 3\:8 :BWim yY~O +sAM ejU% )XVZk FkU} @'he 5\s$t bSp" MKU; x,SX SNn: xfB+.

NCBI CDD Conserved Protein Domain PLN02255

9 дек. 2010 г. - [16].PEGE.[7].C.[1].DDE.[2].DG.[2].GV 77 gi 115462203 1 .[4]. ... YR 72 gi 168066412 1 .[3].GTTFVLVFVPASAAVGILFALTQWYLVSYVTVGKSRV SNNG.[1].M.[1].VDE DG.[2].DA 56 gi 224122948 1 .[4]. .... 602 gi 224122948 526 ...

How Do I Find... - Federal Direct Loans - U.S. Department of Education

... obj < >/Metadata 602 0 R/Outlines 967 0 R/Pages 6703 0 R/StructTreeRoot 971 0 ...... oT4 vEZ4 jQf3L Y;DMK gd@] i"!]3 px}_ 0bdA- 5m@l(P) +OZc C;[c 0mW+ ...... 7t[N 'snN hLa:s\" U8}1 /6mj k4O& Ff~s Uu.4 -OMf u-WX Cenu C]>t eeTc (z7O ...

phpList manual : phpList - phpList.org

22 мая 2015 г. - ... h$ ))) KZZZ n')) x 11 4u||< C_Yyyy #FPRR zy'N 602m =111 DEE1s . ...... >MZZ ))!;; Itt4w oK5; q=z< 'N$!! zIKK deea Gyyy ])++ DG:[ kQII Srr2 U3%% (,,d y99 ...... SO1l 9r$M tdXm LSXF h$// uVTT e[_M wDg[ 8999 8q"M 6}(? snn.

Духовка MBS DG-602: цены в магазинах, стоимость...

Посмотрите сами: MBS DG-601 помимо удобного электронного управления уже имеет удобные телескопические направляющие, встроенные часы с таймером, равномерное распределение тепла благодаря специальной системе вентиляции и многое-многое другое. При этом в духовке Вы можете приготовить одновременно сразу несколько блюд, ведь объём MBS DG-601 целых 70 литров! Но несмотря на количество...

SUPPLEMENTARY METHODS 1) Characterisation of OCCC cell line ...

GD 81, WD FY ABHGA P24. ...... RP11.41701 RP11.602N18 40. RP 11.G1SH20 ... GD F7. C2af43. APOB. NRBP1. KRTCAPS. IFT 172. FN DC4. GCKR.C2af 16.

gi| /home/andreani/potential/BENCHMARK/BM4 ...

... >gi|127514194|Shewanella_loihica|YP_001095391.1| thiol:disulfide interchange protein precursor [Shewanella loihica PV-4] _lim(1-602(1500),602) ...

County Business Patterns

... 04 240 125 507 180 2% 121 184 130117 55 705 20 005 31 701 Payroll,snn (81,000). ... 7700 602 280345 580386 1118804 1522132 793953 901078 752839 1000088 ... 54852 5386 3977 5244 11228 10 528 9016 3937 20% Dg Payroll ...

STOCKHOLM 1.0 #=GF ID Gmad1 #=GF AC PF10647.9 #=GF DE ...

... 20.5 #=GF SE Rigden D #=GF BM hmmbuild HMM.ann SEED.ann #=GF SM hmmsearch -Z 45638612 -E 1000 --cpu ..... avPVLP W5TV83.1/330-602 GGLVKv.

dong s6 64-CTHD/TU

16 мая 2018 г. - s(\: 602 /SNN-VP. Quang tn. ngay 2..1thong 5 nam 2018 v~\iec bao cao So' ... quy dinh.l~. IVo'i 11h{ill: - Nhu tren: - GD Scr(b/e);. - Luu: YT, YP.

High-pT Physics in the Heavy Ion Era by Jan Rak

Cambridge Core - Theoretical Physics and Mathematical Physics - High-pT Physics in the Heavy Ion Era - by Jan Rak.

[ANN] nxSourceMaker 1.0.9 - 1 attachment (1/3) - NexusDB Newsgroups

27 сент. 2003 г. - Changes: added support for table names with spaces. Procedures/unit names are changed replacing all spaces with a _ chracter enjoy

Abschlussbericht IKÜS-Projekt (03KIS055 – 03KIS058) - TU Dresden

1954–1956 und 1976–1978 des Staatlichen Nivellementnetz (SNN) der Deutschen Demokrati- schen Republik (DDR) ...... Basierend auf dem vertikalen Schweregradienten (dg/dz) können Schwereänderungen (Diffe- ...... 1813/9/602. 5,456.

Artificial Intelligence and Soft Computing — ICAISC 2004: 7th ...

Duda, R.O., Hart, P.E., Stork, D.G.: Patter Classification. Instance dataset creation strategy Incremental CNN, IB3, ELH Decremental RNN, SNN, ENN, CA (Chang), ENRBF, DROP1-5, Del Mixed RENN, ... 602 N. Jankowski and M. Grochowski.

Духовой шкаф MBS DG-602

Духовой шкаф MBS DG-602. Духовой шкаф MBS DG-602 3. Описание Цены Магазины рядом Отзывы. Добавить в избранное. Сортировать по: Все отзывы на Яндекс.Маркете. Шемелов Алексей.

m.x.domestica_gdr_reftransV1_0034801, m.x. ...

Name, m.x.domestica_gdr_reftransV1_0034801. Unique Name, m.x.domestica_gdr_reftransV1_0034801. Type, contig. Organism, Malus x domestica (Apple).

NSF Award Search: Award#0601067 - A Program of Medium Energy ...

ABSTRACT The NSF-supported Program of Medium Energy Nuclear Physics will allow the nuclear physics group at the University of Illinois at ...

Водолазка


Однотонная водолазка с длинными рукавами. Модель выполнена из приятного трикотажа. Отличный выбор для базового гардероба.

Цвет: зеленый

Рост девушки-фотомодели 180 см

1790 РУБ

LacyWear dg-355-snn похожие

Подробнее

Туника


Удлиненная туника с длинными рукавами. Модель выполнена из приятного материала. Отличный выбор для повседневного гардероба.

В изделии использованы цвета: бежевый, зеленый и др.

Рост девушки-фотомодели 180 см.

4199 РУБ

LacyWear dg-566-snn похожие

Подробнее

Джемпер


Свободный джемпер с длинными рукавами из вязаного трикотажа. Вязаный трикотаж - это красота, тепло и комфорт. В вязаных вещах очень легко оставаться женственной и в то же время не замёрзнуть.

В изделии использованы цвета: серый, красный

Рост девушки-фотомодели 170 см

2099 РУБ

LacyWear dg-388-snn похожие

Подробнее

Туника


Красивая туника с рукавами 3/4. Модель выполнена из приятного материала. Отличный выбор для повседневного гардероба.

Цвет: синий, коралловый

Ростовка изделия 170 см.

2040 РУБ

LacyWear dg-22-snn похожие

Подробнее

Водолазка


Удобная водолазка приталенного силуэта с длинными рукавами. Модель выполнена из приятного трикотажа. Отличный выбор для повседневного гардероба.

Цвет: фиолетовый

Рост девушки-фотомодели 170 см.

1390 РУБ

LacyWear dg-17-snn похожие

Подробнее

Джемпер


Теплый джемпер с воротником из вязаного трикотажа. Вязаный трикотаж - это красота, тепло и комфорт. В вязанных вещах очень легко оставаться женственной и в то же время не замёрзнуть.

Цвет: бежевый

Рост девушки-фотомодели 173 см

2299 РУБ

LacyWear dg-572-snn похожие

Подробнее

Блузка


Красивая блузка полуприталенного силуэта. Модель выполнена из приятного материала. Отличный выбор для повседневного гардероба.

Цвет: зеленый

Рост девушки-фотомодели 170 см.

1790 РУБ

LacyWear dg-269-snn похожие

Подробнее

Блузка


Цветная блузка свободного силуэта. Модель выполнена из воздушного шифона. Отличный выбор для любого случая.

В изделии использованы цвета: бежевый, красный, зеленый и др.

Ростовка изделия 170 см.

2290 РУБ

LacyWear dg-405-snn похожие

Подробнее

Рубашка


Удобная рубашка с короткими рукавами. Модель выполнена из приятного материала. Отличный выбор для повседневного гардероба.

Цвет: голубой, белый

Рост девушки-фотомодели 180 см

1540 РУБ

LacyWear dg-288-snn похожие

Подробнее

Блузка


Цветная блузка с короткими рукавами. Модель выполнена из приятного материала. Отличный выбор для повседневного гардероба.

В изделии использованы цвета: черный, белый

Рост девушки-фотомодели 170 см.

1290 РУБ

LacyWear dg-477-snn похожие

Подробнее

Джемпер


Прелестный джемпер в винтажном стиле. Модель выполнена из приятного трикотажа. Отличный выбор для повседневного гардероба.

В изделии использованы цвета: серый, розовый

Рост девушки-фотомодели 173 см

3399 РУБ

LacyWear dg-554-snn похожие

Подробнее

Блузка


Однотонный джемпер с длинными рукавами. Модель выполнена из трикотажа. Фигурный вырез горловины. Джемпер придаст Вашему образу женственности и изящества.

В изделии использованы цвета: зеленый

Параметры девушки-фотомодели:
Рост - 174 см
Размер - 52

1499 РУБ

LacyWear dg-683-snn похожие

Подробнее

Джемпер


Свободный джемпер с длинными рукавами из вязаного трикотажа. Вязаный трикотаж - это красота, тепло и комфорт. В вязаных вещах очень легко оставаться женственной и в то же время не замёрзнуть.

В изделии использованы цвета: молочный, черный

Рост девушки-фотомодели 173 см

2099 РУБ

LacyWear dg-574-snn похожие

Подробнее

Блузка


Великолепная блузка свободного силуэта. Модель выполнена из мягкой вискозы. Отличный выбор для повседневного гардероба.

Цвет: желтый, коричневый

Рост девушки-фотомодели 180 см

1599 РУБ

LacyWear dg-131-snn похожие

Подробнее

Комментарии



Подпишитесь на новые товары в minsportzk.ru